RBM45_MOUSE   Q8BHN5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BHN5

Recommended name:RNA-binding protein 45

EC number:

Alternative names:(Developmentally-regulated RNA-binding protein 1) (RB-1) (RNA-binding motif protein 45)

Cleaved into:

GeneID:241490

Gene names  (primary ):Rbm45

Gene names  (synonym ):Drb1 Drbp1

Gene names  (ORF ):

Length:476

Mass:53324

Sequence:MDDAGGLGGSGGFRPGVDSLDEPPNSRIFLVISKHTSELVLRERFSPFGDIQDIWVVRDKHTKESKGVAFVKFARSSQACRAMEEMHGQCLGPSDTKPIKVFIAQSRSSGSHRDVEDEELTRIFVMIPKSYTEEDLREKFKVYGDIEYCSIIKNKVTGESKGLGYVRYLKPSQAAQAIENCDRSFRALLAEPKNKVSGSPEQDDYSSGRQEALGQEPRANLFPFVGEQQSEFSTFDKNDSRGQEAVSKRLSVVSRVPFTEEQLFSIFDIVPGLEYCEVPRDPYSNYGHGVVQYFNVASAIYAKYKLHGFQYPPGNRIVVSFLDDGSNMTELIRKMATQMVAAQLASMVWSTTSQQQFLQYGGNAASQAPQIQTDVVLPSCKKKAPPETPVKERLFVVFNPHPLPLDVLEDIFCRFGNLIEVYLVSGKNVGYVKYADRKSANEAITTLHGKILNGVRLKVMLADSPREESKKRQRTY

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp