YTHD1_MOUSE   P59326


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P59326

Recommended name:YTH domain-containing family protein 1

EC number:

Alternative names:(Dermatomyositis associated with cancer putative autoantigen 1 homolog) (DACA-1 homolog)

Cleaved into:

GeneID:228994

Gene names  (primary ):Ythdf1

Gene names  (synonym ):

Gene names  (ORF ):

Length:559

Mass:60879

Sequence:MSATSVDPQRTKGQDNKVQNGSLHQKDAVHDNDFEPYLSGQSNPSNSYPSMSDPYLSSYYPPSIGFPYSLSEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVVDGQTGFHSDSLNKAPGMNSLEQGMVGLKIGDVTTSAVKTVGSVVNSVALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPIVGGALPPPPIKHNMDIGTWDNKGPAPKASAPQQTPSPQAAPQPQQVAQPLPVQPPPLVQPQYQSPQQPLQPRWVAPRNRNAAFGQSGGANSDSNSVGNAQPTSAPSVESHPVLEKLKAAHSYNPKEFDWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDGAFRSMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEEVVRKERQNRNKQ

Tissue specificity:In brain, preferentially expressed in the hippocampus. {ECO:0000269|PubMed:30401835}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp