KCNE1_MOUSE P23299
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P23299
Recommended name:Potassium voltage-gated channel subfamily E member 1
EC number:
Alternative names:(Delayed rectifier potassium channel subunit IsK) (mISK) (IKs producing slow voltage-gated potassium channel subunit beta Mink) (Minimal potassium channel)
Cleaved into:
GeneID:16509
Gene names (primary ):Kcne1
Gene names (synonym ):
Gene names (ORF ):
Length:129
Mass:14578
Sequence:MSLPNSTTVLPFLARLWQETAEQGGNVSGLARKSQLRDDSKLEALYILMVLGFFGFFTLGIMLSYIRSKKLEHSHDPFNVYIESDAWQEKGKAVFQARVLESFRACYVIENQAAVEQPATHLPELKPLS
Tissue specificity:Restrictively localized in the apical membrane portion of epithelial cells.
Induction:
Developmental stage:
Protein families:Potassium channel KCNE family