DFA23_MOUSE   Q5G866


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5G866

Recommended name:Alpha-defensin 23

EC number:

Alternative names:(Defensin-related cryptdin-23)

Cleaved into:

GeneID:13226

Gene names  (primary ):Defa23

Gene names  (synonym ):Defcr23

Gene names  (ORF ):

Length:93

Mass:10510

Sequence:MKTLVLLSALILLAFQVQADPIQNTDEETKTEEQPGKEDQAVSVSFGDPEGSSLQEESLRDLVCYCRTRGCKRRERMNGTCRKGHLIYTLCCR

Tissue specificity:

Induction:

Developmental stage:

Protein families:Alpha-defensin family


   💬 WhatsApp