DFA22_MOUSE   Q8C1N8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8C1N8

Recommended name:Alpha-defensin 22

EC number:

Alternative names:(Defensin-related cryptdin-22)

Cleaved into:

GeneID:382059

Gene names  (primary ):Defa22

Gene names  (synonym ):Defcr22

Gene names  (ORF ):

Length:93

Mass:10548

Sequence:MKKLVLLSALVLLAYQVQTDPIQNTDEETNTEEQPGEEDQAVSVSFGGQEGSALHEKLSRDLICLCRKRRCNRGELFYGTCAGPFLRCCRRRR

Tissue specificity:

Induction:

Developmental stage:

Protein families:Alpha-defensin family


   💬 WhatsApp