TNR23_MOUSE   Q9ER63


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9ER63

Recommended name:Tumor necrosis factor receptor superfamily member 23

EC number:

Alternative names:(Decoy TRAIL receptor 1) (TNF receptor family member SOB) (TNF receptor homolog 1) (Tumor necrosis factor receptor p60 homolog 1)

Cleaved into:

GeneID:79201

Gene names  (primary ):Tnfrsf23

Gene names  (synonym ):Dctrailr1 Tnfrh1 Tnfrsf1al1

Gene names  (ORF ):

Length:176

Mass:19595

Sequence:MVTFSHVSSLSHWFLLLLLLNLFLPVIFAMPESYSFNCPDGEYQSNDVCCKTCPSGTFVKAPCKIPHTQGQCEKCHPGTFTGKDNGLHDCELCSTCDKDQNMVADCSATSDRKCECQIGLYYYDPKFPESCRPCTKCPQGIPVLQECNSTANTVCSSSVSNPRNWLFLLMLIVFCI

Tissue specificity:Ubiquitous.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp