DCNL5_MOUSE   Q9CXV9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CXV9

Recommended name:DCN1-like protein 5

EC number:

Alternative names:(DCNL5) (DCUN1 domain-containing protein 5) (Defective in cullin neddylation protein 1-like protein 5) (Squamous cell carcinoma-related oncogene 5)

Cleaved into:

GeneID:76863

Gene names  (primary ):Dcun1d5

Gene names  (synonym ):

Gene names  (ORF ):

Length:237

Mass:27579

Sequence:MPVKKKRKAPGVAAAVAEDAGLKKCKIPSYCRSQPPARLISGEEDFSRKKCLAWFYEYAGPDEVVGPEGMEKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQSRFDFLRSQLNDISSFKNIYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHADLSNYDEDGAWPVLLDEFVEWQKIRQTS

Tissue specificity:Highly expressed in testis (PubMed:26906416). Lower expressed in skin, thymus, spleen, lymph nodes and lung (PubMed:26906416). {ECO:0000269|PubMed:26906416}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp