DDB2_MOUSE Q99J79
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99J79
Recommended name:DNA damage-binding protein 2
EC number:
Alternative names:(Damage-specific DNA-binding protein 2)
Cleaved into:
GeneID:107986
Gene names (primary ):Ddb2
Gene names (synonym ):
Gene names (ORF ):
Length:432
Mass:48375
Sequence:MAPKKCPETQKSPDVAVLLRSKSRRGPQELEPEAKKLRVQGPVSSRTCESCCLLAELSSLQIPSRSSSIVRDLYQHKLGKATWSSLQQGLQKSFLHSLASYQVFRKAAPFDRRTTSLAWHPTHPSTLAVGSKGGDIMIWNFGIKDKPIFLKGIGAGGSITGLKFNHLNTNQFFASSMEGTTRLQDFKGNILRVYTSSNSCKVWFCSLDVSAKSRVVVTGDNMGHVILLSTDGKELWNLRMHKKKVAHVALNPCCDWLLATASIDQTVKIWDLRQIKGKDSFLYSLPHRHPVNAACFSPDGARLLTTDQNNEIRVYSASQWDSPLNLISHPHRHFQHLTPIKATWHSRHNLIVVGRYPDPNLKSCVPYELRTIDVFDGSSGKMMCQLYDPGYSGITSLNEFNPMGDTLASTMGYHILIWSQEEDGSQKDHERL
Tissue specificity:Expressed in bone marrow, liver, lung, muscle, pancreas and spleen. {ECO:0000269|PubMed:15558025}.
Induction:
Developmental stage:
Protein families:WD repeat DDB2/WDR76 family