PGRP1_MOUSE O88593
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88593
Recommended name：Peptidoglycan recognition protein 1
EC number：
Alternative names：(Cytokine tag7) (Peptidoglycan recognition protein short) (PGRP-S)
Cleaved into：
GeneID：21946
Gene names (primary )：Pglyrp1
Gene names (synonym )：Pglyrp Pgrp Pgrps Tag7
Gene names (ORF )：
Length：182
Mass：20489
Sequence：MLFACALLALLGLATSCSFIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE
Tissue specificity：Strongly expressed in spleen and lung. Also detected in brain and thymus. In the lung, expressed in the intraalveolar space, in the brain, expressed in the Purkinje cells of the cerebellum and in certain layers of neurons in the hippocampus. Also detected in cells filling the space within the intestinal villus. {ECO:0000269|PubMed:9707603}.
Induction：
Developmental stage：
Protein families：N-acetylmuramoyl-L-alanine amidase 2 family