K2C75_MOUSE Q8BGZ7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BGZ7
Recommended name：Keratin, type II cytoskeletal 75
EC number：
Alternative names：(Cytokeratin-75) (CK-75) (Keratin-6 hair follicle) (mK6hf) (Keratin-75) (K75) (Type II keratin-K6hf) (Type-II keratin Kb18)
Cleaved into：
GeneID：109052
Gene names (primary )：Krt75
Gene names (synonym )：Kb18
Gene names (ORF )：
Length：551
Mass：59741
Sequence：MSRQSTITFHSGSRRGFSTASATTPTAGRSRFSSVSVARSSGNSGGLGRISGIGSGFGSRSLYNLGGTRRVSIGGCAGSGFRGGFGGRTSSGFGGSSGFAYGGGIGGGFGGPGFSVCPSGGIQEVTVNQSLLTPLNLQIDPTIQRVRKEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQEQGSRTVRQNLEPFFDTYVNDLRRQLDGITAERGRLDAELRNMQEVVEDFKVRYEDEINKRAAAENEFVGLKKDVDSAYMNKVELEAKVDSLTDQINFYRMIYEAELSQMQNQVSDTSVVLSMDNNRSLDLDSIIAEVKAQYEDIANRSRAEAESWYQTKYEELQVTAGRHGDDLRNTKQEISEMNRMIQRLRSEIDAVKKQCSSLQTAISDAEQRGELALKDARAKLMELEDALQKAKQDMARLLREYQELMNVKLALDVEIATYRKLLEGEECRLSGEGVSPVNISVVTSTVSSGYGGGANIGGGSLGLGGNSGYSFTTSGGHSLGTGLGGSGFTTTSSRGPVGSGSSIKFVSSTSSRKSYKH
Tissue specificity：Expressed in the companion layer and upper germinative matrix region of the hair follicle and the medulla of the hair shaft. Also expressed in epithelia of the nail bed and fungiform papillae of dorsal tongue epithelium (at protein level). {ECO:0000269|PubMed:11489919, ECO:0000269|PubMed:14675170, ECO:0000269|PubMed:17851587}.
Induction：
Developmental stage：
Protein families：Intermediate filament family