K1C40_MOUSE   Q6IFX3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6IFX3

Recommended name:Keratin, type I cytoskeletal 40

EC number:

Alternative names:(Cytokeratin-40) (CK-40) (Keratin-40) (K40) (Type I hair keratin Ka36)

Cleaved into:

GeneID:406221

Gene names  (primary ):Krt40

Gene names  (synonym ):Ka36

Gene names  (ORF ):

Length:439

Mass:48928

Sequence:MASDGSPSCCSSEPCAGASGCATASFCPTNTTCLPNTCSTSRCQTPSFLCRASLPACCLSPCYLAGGCNSPCLVGSCAWCEEGSFNSNEKETMQFLNDRLASYLERVRSLEENNAELECRIREQCEPNAPLVCPDYQRYFDTIEELQQKILCTKAENSRLAVQVDNCKLAADDFRSKYESELSLRQLVENDITGLRGILGELTLCKSDLEAHVESMKDDLICLKKGHEEEVNLLREQLGDRLSVELDTAPTVDLNKVLDEMRCQYERVLANNRRDAEEWFAAQTEELNQQQKSSAEQLEGCQTEMLELKRKANTLEIELQAQQTLTESLECTVAETEAQYSTQLAQMQCLIDSVEHQLAEIRCDLERQNQEYQVLLDTKARLECEINTYRGLLEKEDSRLPCNPGSGAPMPNSTCEPCSNSMCEPCSAYVICTVENCCA

Tissue specificity:

Induction:

Developmental stage:

Protein families:Intermediate filament family


   💬 WhatsApp