K1C27_MOUSE Q9Z320
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z320
Recommended name：Keratin, type I cytoskeletal 27
EC number：
Alternative names：(Cytokeratin-27) (CK-27) (Keratin complex-1, acidic, gene C29) (Keratin-27) (K27) (Type I inner root sheath-specific keratin-K25irs3)
Cleaved into：
GeneID：16675
Gene names (primary )：Krt27
Gene names (synonym )：c29 Krt1-c29
Gene names (ORF )：
Length：448
Mass：49105
Sequence：MSVRFSSASRRLGSVRLSSAGAALGAGNACGVPGIGSGFSCAFGGSSLAGGLGMGGASCGAFTANEHGLLSGNEKVTMQNLNDRLASYLENVQALEEANADLEQKIKDWYEKFGPGSCRGLDHDYSRYFPIIDDLRTQIISATAHNANIILQNDNARLTADDFRMKYENELALHQSVDADINGLRRVLDELTLCRTDLEVQLETLSEELAYLKKNHEEEMQALQCAAGGNVNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFQEKSASLQQQISDDAGATTSARNELTEMKRTLQTLEIELQSLLAMKHSLECSLTETEGNYCTQLAQIQAQISALEEQLHQVRTETEGQKLEYEQLLNVKAHLEKEIETYCRLIDGDEGSCVKAKGQGRPGNQTKDSPKTAIVKTVVEELDPRGKVLSSRVHTLEEKSTKVNKTEQRIPS
Tissue specificity：Expressed in skin. Expressed in the Henle layer and cuticle of the irs in hair follicle bulb. In the hair follicle, expression was observed in all layers of the irs but was stronger in the Henle layer and cuticle than the Huxley layer until the Henle layer differentiated (at protein level). {ECO:0000269|PubMed:10087197, ECO:0000269|PubMed:14996088}.
Induction：
Developmental stage：
Protein families：Intermediate filament family