K2C1B_MOUSE   Q6IFZ6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6IFZ6

Recommended name:Keratin, type II cytoskeletal 1b

EC number:

Alternative names:(Cytokeratin-1B) (CK-1B) (Embryonic type II keratin-1) (Keratin-77) (K77) (Type-II keratin Kb39)

Cleaved into:

GeneID:406220

Gene names  (primary ):Krt77

Gene names  (synonym ):Krt1b

Gene names  (ORF ):

Length:572

Mass:61359

Sequence:MSRQFSSQSAFSSRSRRAYSSRSSSGFGGGRQALVSVSQSRRYGGDYGGGFSSRSLYSLGGSKSIFGNLVGRSASGFCQSRGPGGGFGGGIGGGIGGGRGFGGGGFGGGYGGGGRFGGGFGGAGFGFGGFGPSYPPGGIHEVTINQSLLEPLHLEVDPEIQRVKTQEREQIKTLNNKFASFIDKVRFLEQQNQVLQTKWELLQQVNTSTRTSSLEPVFEEFISQLQRQVDVLTTEQLRQNTEIRNMQDVVEDYKNKYEDEINKRTNAENDFVVLKKDVDAAFMGKSDLQSKVDTLYGEINFLKYLFDTELSQIQTHVSDTNVILSMDNNRSLDLDSIIDAVRAQYEIIAQKSKDEAEALYQTKYQELQITAGKHGDDLKNSKMEISELNRNIQRLRAEIANIKKQVEGMHGLISDAEERGERALQNAKQKLQDMEEALQQAKEDLAKLLRDYQAMLGAKLSLDVEIATYRQLLEGEESRMSGALQSQVSISVQSSQVTIGGGGGGSGSYSGSSRGGGGGGGGTGSRGGGGGGGGSSYVSSSRSATKYGSGGGSSRTQILQTSTHSSRRHVVE

Tissue specificity:Expressed in stratified epithelia. {ECO:0000269|PubMed:15085952}.

Induction:

Developmental stage:

Protein families:Intermediate filament family


   💬 WhatsApp