CX7A1_MOUSE P56392
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P56392
Recommended name:Cytochrome c oxidase subunit 7A1, mitochondrial
EC number:
Alternative names:(Cytochrome c oxidase subunit VIIa-heart) (Cytochrome c oxidase subunit VIIa-H) (Cytochrome c oxidase subunit VIIa-muscle) (Cytochrome c oxidase subunit VIIa-M)
Cleaved into:
GeneID:12865
Gene names (primary ):Cox7a1
Gene names (synonym ):Cox7a Cox7ah
Gene names (ORF ):
Length:80
Mass:8986
Sequence:MRALRVSQALVRSFSSSTRSHLENRVAEKQKLFQADNDLPVHLKGGGMDNVLYRLTMTLTLGGTAYCLYCLGWASFPHKK
Tissue specificity:
Induction:
Developmental stage:
Protein families:Cytochrome c oxidase VIIa family