CX6B2_MOUSE   Q80ZN9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q80ZN9

Recommended name:Cytochrome c oxidase subunit 6B2

EC number:

Alternative names:(Cytochrome c oxidase subunit VIb isoform 2) (COX VIb-2) (Cytochrome c oxidase subunit VIb, testis-specific isoform)

Cleaved into:

GeneID:333182

Gene names  (primary ):Cox6b2

Gene names  (synonym ):

Gene names  (ORF ):

Length:88

Mass:10521

Sequence:MLGVQAQKPPPGQWTTPPFDPRFPNQNQTRNCYQNFLDYHRCVKTMNRRGKSTQPCEYYFRVFHSLCPISWVQRWNEQIKQGTFPGKI

Tissue specificity:Testis specific. {ECO:0000269|PubMed:12874793}.

Induction:

Developmental stage:

Protein families:Cytochrome c oxidase subunit 6B family


   💬 WhatsApp