COX7C_MOUSE   P17665


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P17665

Recommended name:Cytochrome c oxidase subunit 7C, mitochondrial

EC number:

Alternative names:(Cytochrome c oxidase polypeptide VIIc)

Cleaved into:

GeneID:12867

Gene names  (primary ):Cox7c

Gene names  (synonym ):Cox7c1

Gene names  (ORF ):

Length:63

Mass:7333

Sequence:MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWRLLAMMTVYFGSGFAAPFFIVRHQLLKK

Tissue specificity:

Induction:

Developmental stage:

Protein families:Cytochrome c oxidase VIIc family


   💬 WhatsApp