CX6A1_MOUSE P43024
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P43024
Recommended name：Cytochrome c oxidase subunit 6A1, mitochondrial
EC number：
Alternative names：(Cytochrome c oxidase polypeptide VIa-liver)
Cleaved into：
GeneID：12861
Gene names (primary )：Cox6a1
Gene names (synonym )：Cox6al
Gene names (ORF )：
Length：111
Mass：12352
Sequence：MASAVLSASRVSRPLGRALPGLRRPMSSGAHGEEGSARMWKALTYFVALPGVGVSMLNVFLKSRHEEHERPPFVAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE
Tissue specificity：
Induction：
Developmental stage：
Protein families：Cytochrome c oxidase subunit 6A family