COX41_MOUSE P19783
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P19783
Recommended name：Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
EC number：
Alternative names：(Cytochrome c oxidase polypeptide IV) (Cytochrome c oxidase subunit IV isoform 1) (COX IV-1)
Cleaved into：
GeneID：12857
Gene names (primary )：Cox4i1
Gene names (synonym )：Cox4 Cox4a
Gene names (ORF )：
Length：169
Mass：19530
Sequence：MLASRALSLIGKRAISTSVCLRAHGSVVKSEDYAFPTYADRRDYPLPDVAHVTMLSASQKALKEKEKADWSSLSRDEKVQLYRIQFNESFAEMNRGTNEWKTVVGMAMFFIGFTALVLIWEKSYVYGPIPHTFDRDWVAMQTKRMLDMKANPIQGFSAKWDYDKNEWKK
Tissue specificity：
Induction：
Developmental stage：
Protein families：Cytochrome c oxidase IV family