COX8C_MOUSE   A6H666


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A6H666

Recommended name:Cytochrome c oxidase subunit 8C, mitochondrial

EC number:

Alternative names:(Cytochrome c oxidase polypeptide 8 isoform 3) (Cytochrome c oxidase polypeptide VIII isoform 3) (COX VIII-3) (Cytochrome c oxidase subunit 8-3)

Cleaved into:

GeneID:75483

Gene names  (primary ):Cox8c

Gene names  (synonym ):

Gene names  (ORF ):

Length:72

Mass:8009

Sequence:MSRLLLLCSSLLRHRAVLFSKPGHPGRLSHSESPQKKILSPTESAVGIVVFFTTFYIPAAYVLSSLKYFKGE

Tissue specificity:

Induction:

Developmental stage:

Protein families:Cytochrome c oxidase VIII family


   💬 WhatsApp