RETNA_MOUSE   Q9EP95


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9EP95

Recommended name:Resistin-like alpha

EC number:

Alternative names:(Cysteine-rich secreted protein A12-gamma) (Cysteine-rich secreted protein FIZZ1) (Hypoxia-induced mitogenic factor) (Parasite-induced macrophage novel gene 1 protein) (RELMalpha)

Cleaved into:

GeneID:57262

Gene names  (primary ):Retnla

Gene names  (synonym ):Fizz1 Himf Pmng1

Gene names  (ORF ):

Length:111

Mass:11936

Sequence:MKTTTCSLLICISLLQLMVPVNTDETIEIIVENKVKELLANPANYPSTVTKTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLS

Tissue specificity:Highest levels in adipose tissue.

Induction:

Developmental stage:

Protein families:Resistin/FIZZ family


   💬 WhatsApp