RBTN2_MOUSE P25801
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P25801
Recommended name：Rhombotin-2
EC number：
Alternative names：(Cysteine-rich protein TTG-2) (LIM domain only protein 2) (LMO-2) (T-cell translocation protein 2)
Cleaved into：
GeneID：16909
Gene names (primary )：Lmo2
Gene names (synonym )：Rbtn-2 Rbtn2 Rhom-2
Gene names (ORF )：
Length：158
Mass：18340
Sequence：MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGII
Tissue specificity：Expressed in early mouse development in central nervous system, lung, kidney, liver and spleen but only very low levels occur in thymus. {ECO:0000269|PubMed:2034676}.
Induction：
Developmental stage：
Protein families：