RBTN1_MOUSE Q924W9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q924W9
Recommended name：Rhombotin-1
EC number：
Alternative names：(Cysteine-rich protein TTG-1) (LIM domain only protein 1) (LMO-1) (T-cell translocation protein 1)
Cleaved into：
GeneID：109594
Gene names (primary )：Lmo1
Gene names (synonym )：Rbtn1 Rhom1 Ttg1
Gene names (ORF )：
Length：156
Mass：17805
Sequence：MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQVDYEEGHLNGTFESQVQ
Tissue specificity：Expressed in the brain and not in the thymus. {ECO:0000269|PubMed:1703797}.
Induction：
Developmental stage：
Protein families：