CLTR1_MOUSE Q99JA4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99JA4
Recommended name:Cysteinyl leukotriene receptor 1
EC number:
Alternative names:(CysLTR1) (Cysteinyl leukotriene D4 receptor) (LTD4 receptor)
Cleaved into:
GeneID:58861
Gene names (primary ):Cysltr1
Gene names (synonym ):Cyslt1 Cyslt1r
Gene names (ORF ):
Length:352
Mass:40715
Sequence:MYLQGTKQTFLENMNGTENLTTSLINNTCHDTIDEFRNQVYSTMYSVISVVGFFGNSFVLYVLIKTYHEKSAFQVYMINLAIADLLCVCTLPLRVVYYVHKGKWLFGDFLCRLTTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNINLVTQKKARFVCIGIWIFVILTSSPFLMYKSYQDEKNNTKCFEPPQNNQAKKYVLILHYVSLFFGFIIPFVTIIVCYTMIILTLLKNTMKKNMPSRRKAIGMIIVVTAAFLVSFMPYHIQRTIHLHLLHSETRPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTFRKHSLSSMTYVPKKKASLPEKGEEICNE
Tissue specificity:Widely expressed, with higher expression in the lung and skin, intermediate levels in the heart, kidney and stomach and lower levels in several other tissues. Isoform 1 is the most abundant form in all tested tissues.
Induction:
Developmental stage:
Protein families:G-protein coupled receptor 1 family