CP2F2_MOUSE P33267
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P33267
Recommended name：Cytochrome P450 2F2
EC number：EC 1.14.14.-
Alternative names：(CYPIIF2) (Cytochrome P450-NAH-2) (Naphthalene dehydrogenase) (Naphthalene hydroxylase)
Cleaved into：
GeneID：13107
Gene names (primary )：Cyp2f2
Gene names (synonym )：Cyp2f-2
Gene names (ORF )：
Length：491
Mass：55949
Sequence：MDGVSTAILLLLLAVISLSLTFSSRGKGQLPPGPKPLPILGNLLQLRSQDLLTSLTKLSKEYGSVFTVYLGSRPVIVLSGYQTVKEALVDKGEEFSGRGAYPVFFNFTRGNGIAFSDGERWKILRRFSVQILRNFGMGKRSIEERILEEGSFLLEVLRKMEGKPFDPVFILSRSVSNIICSVVFGSRFDYDDERLLTIIHFINDNFKIMSSPWGEMYNIFPSVLDWIPGPHKRLFRNFGGMKDLIARSVREHQDSLDPNSPRDFIDCFLTKMAQEKQDPLSHFNMDTLLMTTHNLLFGGTETVGTTLRHAFLILMKYPKVQARVQEEIDRVVGRSRMPTLEDRTSMPYTDAVIHEVQRFADVIPMNLPHRVTRDTPFRGFLIPKGTDVITLLNTVHYDSDQFKTPQEFNPEHFLDDNHSFKKSPAFMPFSAGRRLCLGEPLARMELFIYFTSILQNFTLQPLVDPEDIDLTPLSSGLGNLPRPFQLCMHIR
Tissue specificity：Clara cells in lung and liver. {ECO:0000269|PubMed:1742282, ECO:0000269|PubMed:1981702}.
Induction：
Developmental stage：
Protein families：Cytochrome P450 family