CP270_MOUSE Q91W64
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91W64
Recommended name：Cytochrome P450 2C70
EC number：EC 1.14.14.-
Alternative names：(CYPIIC70)
Cleaved into：
GeneID：226105
Gene names (primary )：Cyp2c70
Gene names (synonym )：Cyp2c-70 Cyp2c22
Gene names (ORF )：
Length：489
Mass：56020
Sequence：MALFIFLGIWLSCFLFLFLWNQHRGRGKLPPGPTPLPIVGNILQVDVKNISKSMGMLAKKYGPVFTVYLGMKPTVVLHGYKAMKEALIDQGDEFSDKTDSSLLSRTSQGLGIVFSNGETWKQTRRFSLMVLRSMGMGKKTIEDRIQEEILYMLDALRKTNGSPCDPSFLLACVPCNVISTVIFQHRFDYNDQTFQDFMENFHRKIEILASPWSQLCSAYPILYYLPGIHNRFLKDVTQQKKFILEEINRHQKSLDLSNPQDFIDYFLIKMEKEKHNQKSEFTMDNLVVSIGDLFGAGTETTSSTVKYGLLLLLKYPEVTAKIQEEIAHVIGRHRRPTMQDRNHMPYTDAVLHEIQRYIDFVPIPSPRKTTQDVEFRGYHIPKGTSVMACLTSVLNDDKEFPNPEKFDPGHFLDEKGNFKKSDYFVAFSAGRRACIGEGLARMEMFLILTNILQHFTLKPLVKPEDIDTKPVQTGLLHVPPPFELCFIPV
Tissue specificity：Expressed in liver. {ECO:0000269|PubMed:27638959}.
Induction：
Developmental stage：
Protein families：Cytochrome P450 family