CP270_MOUSE   Q91W64


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91W64

Recommended name:Cytochrome P450 2C70

EC number:EC 1.14.14.-

Alternative names:(CYPIIC70)

Cleaved into:

GeneID:226105

Gene names  (primary ):Cyp2c70

Gene names  (synonym ):Cyp2c-70 Cyp2c22

Gene names  (ORF ):

Length:489

Mass:56020

Sequence:MALFIFLGIWLSCFLFLFLWNQHRGRGKLPPGPTPLPIVGNILQVDVKNISKSMGMLAKKYGPVFTVYLGMKPTVVLHGYKAMKEALIDQGDEFSDKTDSSLLSRTSQGLGIVFSNGETWKQTRRFSLMVLRSMGMGKKTIEDRIQEEILYMLDALRKTNGSPCDPSFLLACVPCNVISTVIFQHRFDYNDQTFQDFMENFHRKIEILASPWSQLCSAYPILYYLPGIHNRFLKDVTQQKKFILEEINRHQKSLDLSNPQDFIDYFLIKMEKEKHNQKSEFTMDNLVVSIGDLFGAGTETTSSTVKYGLLLLLKYPEVTAKIQEEIAHVIGRHRRPTMQDRNHMPYTDAVLHEIQRYIDFVPIPSPRKTTQDVEFRGYHIPKGTSVMACLTSVLNDDKEFPNPEKFDPGHFLDEKGNFKKSDYFVAFSAGRRACIGEGLARMEMFLILTNILQHFTLKPLVKPEDIDTKPVQTGLLHVPPPFELCFIPV

Tissue specificity:Expressed in liver. {ECO:0000269|PubMed:27638959}.

Induction:

Developmental stage:

Protein families:Cytochrome P450 family


   💬 WhatsApp