CP240_MOUSE P56657
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P56657
Recommended name：Cytochrome P450 2C40
EC number：EC 1.14.14.-
Alternative names：(CYPIIC40)
Cleaved into：
GeneID：13099
Gene names (primary )：Cyp2c40
Gene names (synonym )：
Gene names (ORF )：
Length：491
Mass：55763
Sequence：MDPFVVLVLCLSFLLVLSLWRQRSARGNLPPGPTPLPIIGNYHLIDMKDIGQCLTNFSKTYGPVFTLYFGSQPIVVLHGYEAIKEALIDHGEEFSGRGRIPVFDKVSTGKGIGFSHGNVWKATRVFTVNTLRNLGMGKRTIENKVQEEAQWLMKELKKTNGSPCDPQFIIGCAPCNVICSIVFQNRFDYKDKDFLSLIGKVNECTEILSSPGCQIFNAVPILIDYCPGSHNKLFKNHTWIKSYLLGKIKEHEESLDVTNPRDFIDYFLIQRRQKNGIEHMDYTIEHLATLVTDLVFGGTETLSSTMRFALLLLMKHTHITAKVQEEIDNVIGRHRSPCMQDRNHMPYTNAMVHEVQRYIDLGPNGVVHEVTCDTKFRNYFIPKGTQVMTSLTSVLHDSTEFPNPEVFDPGHFLDDNGNFKKSDYFVPFSAGKRICVGESLARMELFLFLTTILQNFKLKPLVDPKDIDMTPKHSGFSKIPPNFQMCFIPVE
Tissue specificity：Liver, brain, kidney, and intestine, with trace amounts in lung and heart (PubMed:9721182, PubMed:10908295). Expressed throughout the intestinal tract, with higher expression levels in jejunum, cecum and colon (PubMed:10908295). {ECO:0000269|PubMed:10908295, ECO:0000269|PubMed:9721182}.
Induction：
Developmental stage：
Protein families：Cytochrome P450 family