CP2B9_MOUSE P12790
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P12790
Recommended name：Cytochrome P450 2B9
EC number：EC 1.14.14.1
Alternative names：(CYPIIB9) (Cytochrome P450 clone PF26) (Cytochrome P450-16-alpha) (Testosterone 16-alpha hydroxylase)
Cleaved into：
GeneID：13094
Gene names (primary )：Cyp2b9
Gene names (synonym )：Cyp2b-9 Rip
Gene names (ORF )：
Length：491
Mass：55741
Sequence：MDPSVLLLLAVLLSLFLLLVRGHAKIHGHLPPGPHPLPLLGNLLQMDRGGLLKCFIQLQEKHGDVFTVHLGPRPVVVLCGTQTIREALVDHAEAFSGRGTIAAAQLVMQDYGIFFASGQRWKTLRRFSLATMKEFGMGKRSVEERIKEEAQCLVEELKKYQGVPLDPTFLFQCITANIICSIVFGERFDYTDDQFLHLLNLMYKIFSLLSSFSGQMFELFSGFLKYFPGVHRQIVKKQQELLDYIAHSVEKHKATLDPSAPRDYIDTYLLRMEKEKSNHNTEFHHQNLMMSVLSLFFAGTETTSATLHYGVLLMLKYPHVTEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHEIQRFSDLVPIGLPHKVIKDTLFRGYLLPKNTEVYPVLSSALHDPQYFEQPDKFNPEHFLDANGALKKCEAFLPFSTGKRICLGESIARNELFIFFTTILQNFSVASPVAPKDIDLTPKESGIGKIPPAHQIYFLAR
Tissue specificity：
Induction：
Developmental stage：
Protein families：Cytochrome P450 family