CP2A4_MOUSE P15392
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P15392
Recommended name：Cytochrome P450 2A4
EC number：EC 1.14.14.1
Alternative names：(CYPIIA4) (Cytochrome P450-15-alpha) (Cytochrome P450-IIA3.1) (Testosterone 15-alpha-hydroxylase)
Cleaved into：
GeneID：13086
Gene names (primary )：Cyp2a4
Gene names (synonym )：Cyp2a-4
Gene names (ORF )：
Length：494
Mass：56782
Sequence：MLTSGLLLVAAVAFLSVLVLMSVWKQRKLSGKLPPGPTPLPFVGNFLQLNTEQMYNSLMKISQRYGPVFTIYLGSRRIVVLCGQETVKEALVDQAEEFSGRGEQATFDWLFKGYGIAFSSGERAKQLRRFSITTLRDFGVGKRGIEERIQEEAGFLIDSFRKTNGAFIDPTFYLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSLQFTATSMGQVYEMFSSVMKHLPGPQQQAFKELQGLEDFITKKVEHNQRTLDPNSPRDFIDSFLIRMLEEKKNPNTEFYMKNLVLTTLNLFFAGTETVSTTLRYGFLLLMKYPDIEAKVHEEIDRVIGRNRQPKYEDRMKMPYTEAVIHEIQRFADLIPMGLARRVTKDTKFRDFLLPKGTEVFPMLGSVLKDPKFFSNPKDFNPKHFLDDKGQFKKSDAFVPFSIGKRYCFGEGLARMELFLFLTNIMQNFHFKSTQEPQDIDVSPRLVGFVTIPPTYTMSFLSR
Tissue specificity：Kidney and lung. Expressed in liver, with a strong circadian rhythmicity. Circadian expression is regulated by DBP. {ECO:0000269|PubMed:10490589}.
Induction：
Developmental stage：
Protein families：Cytochrome P450 family