CDN1C_MOUSE   P49919


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P49919

Recommended name:Cyclin-dependent kinase inhibitor 1C

EC number:

Alternative names:(Cyclin-dependent kinase inhibitor p57) (p57Kip2)

Cleaved into:

GeneID:12577

Gene names  (primary ):Cdkn1c

Gene names  (synonym ):Kip2

Gene names  (ORF ):

Length:348

Mass:37372

Sequence:MGMSDVYLRSRTAMERLASSDTFPVIARSSACRSLFGPVDHEELGRELRMRLAELNAEDQNRWDFNFQQDVPLRGPGRLQWMEVDSESVPAFYRETVQVGRCRLQLGPRPPPVAVAVIPRSGPPAGEAPDGLEEAPEQPPSAPASAVVAEPTPPATPAPASDLTSDPIPEVTLVATSDPTPDPIPDANPDVATRDGEEQVPEQVSEQGEESGAEPGDELGTEPVSEQGEEQGAEPVEEKDEEPEEEQGAEPVEEQGAEPVEEQNGEPVEEQDENQEQRGQELKDQPLSGIPGRPAPGTAAANANDFFAKRKRTAQENKASNDVPPGCPSPNVAPGVGAVEQTPRKRLR

Tissue specificity:Expressed in the heart, brain, lung, skeletal muscle, kidney, pancreas and testis. High levels are seen in the placenta while low levels are seen in the liver.

Induction:

Developmental stage:

Protein families:CDI family


   💬 WhatsApp