CLC6A_MOUSE Q9JKF4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JKF4
Recommended name：C-type lectin domain family 6 member A
EC number：
Alternative names：(C-type lectin superfamily member 10) (Dendritic cell-associated C-type lectin 2) (DC-associated C-type lectin 2) (Dectin-2)
Cleaved into：
GeneID：56620
Gene names (primary )：Clec6a
Gene names (synonym )：Clec4n Clecsf10 Dectin2
Gene names (ORF )：
Length：209
Mass：24324
Sequence：MVQERQSQGKGVCWTLRLWSAAVISMLLLSTCFIASCVVTYQFIMDQPSRRLYELHTYHSSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLISTKENFWSTSEQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLSDPQGNGKWQWIDDTPFSQNVRFWHPHEPNLPEERCVSIVYWNPSKWGWNDVFCDSKHNSICEMKKIYL
Tissue specificity：Expressed by the XS52 DC (dendritic cell) line (at protein level). Expressed constitutively by the epidermis, and skin resident DC appear to be the major source of this expression. Expressed in the spleen and thymus. Expression was undetectable in non-DC lines, including macrophage lines (J774 and Raw), T-cell lines (7-17, HDK-1, and D10), B-cell hybridoma (5C5), a keratinocyte line (Pam 212), and a fibroblast line (NS01). {ECO:0000269|PubMed:10766825}.
Induction：
Developmental stage：
Protein families：