CTF1_MOUSE Q60753
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q60753
Recommended name:Cardiotrophin-1
EC number:
Alternative names:(CT-1)
Cleaved into:
GeneID:13019
Gene names (primary ):Ctf1
Gene names (synonym ):
Gene names (ORF ):
Length:203
Mass:21509
Sequence:MSQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA
Tissue specificity:Highly expressed in heart, skeletal muscle, liver, lung and kidney. Lower levels in testis and brain. No expression in spleen.
Induction:
Developmental stage:
Protein families:IL-6 superfamily