CPNS1_MOUSE O88456
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88456
Recommended name：Calpain small subunit 1
EC number：
Alternative names：(CSS1) (Calcium-activated neutral proteinase small subunit) (CANP small subunit) (Calcium-dependent protease small subunit) (CDPS) (Calcium-dependent protease small subunit 1) (Calpain regulatory subunit)
Cleaved into：
GeneID：12336
Gene names (primary )：Capns1
Gene names (synonym )：Capn4
Gene names (ORF )：
Length：269
Mass：28463
Sequence：MFLVNSFLKGGGGGGGGGGLGGGLGNVLGGLISGAAGGGGGGGGGGMGLGGGGGGGGTAMRILGGVISAISEAAAQYNPEPPPPRSHYSNIEANESEEVRQFRKLFVQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKRFDTDRSGTIGSHELPGAFEAAGFHLNEHLYSMIIRRYADESGNMDFDNFISCLVRLDAMFRAFKSLDKNGTGQIQVNIQEWLQLTMYS
Tissue specificity：
Induction：
Developmental stage：
Protein families：