CSRN2_MOUSE Q8BGQ2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BGQ2
Recommended name：Cysteine/serine-rich nuclear protein 2
EC number：
Alternative names：(CSRNP-2) (Protein FAM130A1) (TGF-beta-induced apoptosis protein 12) (TAIP-12)
Cleaved into：
GeneID：207785
Gene names (primary )：Csrnp2
Gene names (synonym )：Fam130a1 Taip12
Gene names (ORF )：
Length：534
Mass：58504
Sequence：MDAFSGSGLKRKFDDVDVGSSVSNSDDEMSSSDSADSCDSLNPPTTASFTPTSILKRQKQLRRKNVRFDQVTVYYFARRQGFTSVPSQGGSSLGMAQRHNSVRSYTLCEFAQEQEVNHREILREHLKEEKLHAKKMKLTKNGTVESVEADGLTLDDVSDEDIDVENVEVDDYFFLQPLPTKRRRALLRASGVHRIDAEEKQELRAIRLSREECGCDCRLYCDPEACACSQAGIKCQVDRMSFPCGCSRDGCGNMAGRIEFNPIRVRTHYLHTIMKLELESKRQVSRPAAEEEPLPGAQSSQTQDFQEFIAENETAVMHLQSAEELERLKAEEDSSGSSASLDSSMESLGVCILEEPLAVPQELCPGLAAPILIQAQLPPGSSVLCFTENSEHPAASPMSSPSYLNSGPLVYYQVEQRPVVGVKAESGSEEGPASFPKEKDLSVFSLPVTSLVACGPSASAALCKPEVGKTSSLNKLLPEDCGLKEPESEDLHPSWSPSSLPFRTDNEEGCGVQNSQQSEDRTSEDSALELPLAV
Tissue specificity：Highest expression detected in thymus, brain and ovary. Low levels detected in naive T-cells. {ECO:0000269|PubMed:17726538}.
Induction：
Developmental stage：
Protein families：AXUD1 family