DJC24_MOUSE   Q91ZF0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91ZF0

Recommended name:DnaJ homolog subfamily C member 24

EC number:

Alternative names:(CSL-type zinc finger-containing protein 3) (Diphthamide biosynthesis protein 4) (J domain protein DjC7)

Cleaved into:

GeneID:99349

Gene names  (primary ):Dnajc24

Gene names  (synonym ):Dph4 Zcsl3

Gene names  (ORF ):

Length:148

Mass:16922

Sequence:MALEQTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKILGNEETKKKYDLQRHEDELRNVGPVDAQVRLEEMSWNQGDESFFLSCRCGGKYTVSKDEAQEATLISCDACSLIVELLHQS

Tissue specificity:Detected in heart, brain, spleen, lung, liver, kidney and testis. {ECO:0000269|PubMed:11595173}.

Induction:

Developmental stage:

Protein families:DPH4 family


   💬 WhatsApp