CNRP1_MOUSE   Q5M8N0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5M8N0

Recommended name:CB1 cannabinoid receptor-interacting protein 1

EC number:

Alternative names:(CRIP-1)

Cleaved into:

GeneID:380686

Gene names  (primary ):Cnrip1

Gene names  (synonym ):

Gene names  (ORF ):

Length:164

Mass:18612

Sequence:MGDLPGLVRLSIALRIQPNDGPVFFKVDGQRFGQNRTIKLLTGSSYKVEVKIKPTTLQVENISIGGVLVPLELKGKEPDGERVVYTGIYDTEGVAPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL

Tissue specificity:Highly expressed in brain. Also detected in heart, lung, intestine, kidney, testis, spleen, liver and muscle (at protein level). {ECO:0000269|PubMed:17895407}.

Induction:

Developmental stage:

Protein families:CNRIP family


   💬 WhatsApp