CDK6_MOUSE Q64261
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64261
Recommended name：Cyclin-dependent kinase 6
EC number：EC 2.7.11.22
Alternative names：(CR2 protein kinase) (CRK2) (Cell division protein kinase 6) (Serine/threonine-protein kinase PLSTIRE)
Cleaved into：
GeneID：12571
Gene names (primary )：Cdk6
Gene names (synonym )：Cdkn6 Crk2
Gene names (ORF )：
Length：326
Mass：37028
Sequence：MEKDSLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTSEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDIIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYGALNHPYFQDLERYKDNLNSHLPSNQSTSELNTA
Tissue specificity：Expressed in subgranular zone (SGZ) of the hippocampal dentate gyrus (DG) and the subventricular zone (SVZ) of the lateral ventricles whose neural precursor cells (NPC) give rise to dentate granule neurons and olfactory bulb (OB) interneurons, respectively. Expressed in the neuroepithelium of the cerebral cortex of the developing brain. {ECO:0000269|PubMed:21319271, ECO:0000269|PubMed:23918663}.
Induction：
Developmental stage：
Protein families：Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily