CBPN_MOUSE   Q9JJN5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JJN5

Recommended name:Carboxypeptidase N catalytic chain

EC number:EC 3.4.17.3

Alternative names:(CPN) (Carboxypeptidase N polypeptide 1) (Carboxypeptidase N small subunit)

Cleaved into:

GeneID:93721

Gene names  (primary ):Cpn1

Gene names  (synonym ):

Gene names  (ORF ):

Length:457

Mass:51845

Sequence:MPDLPSAFLPLLLLSKFVTPVTFRHHRYDDLVRTLYKVHNQCPDITRLYNIGRSVKGRYLYVLEFSDYPGIHEPLEPEVKYVGNMHGNEVLGRELLLQLSEFLCEEFRNRNQRILRLIQDTRIHILPSMNPDGYEVAAAQGPNMSGYLVGRNNANGVDLNRNFPDLNTYFYYNSKNGGPNHHLPLPDNWKSQVEPETRAVIQWIRSLNFVLSANMHGGAVVANYPYDKSLEHRFRGPHRTSNSPTPDDELFQTLAKVYSYAHGWMHQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPRQEELQREWLGNREALIQFLEQVHQGIKGMVLDENSNNLTGAVISVTGINHDVTSGEHGDYFRLLLPGTYSVTAKAPGYDPKTVTVTVGPAGPTVVDFQLKRSSSQVYPVQRAPGRGQGGRAKQPRTSRKKDPATKRHRGPA

Tissue specificity:Mainly expressed in liver. Also detected in lung, stomach, intestine, spleen and kidney. {ECO:0000269|PubMed:10878383, ECO:0000269|PubMed:11342641}.

Induction:

Developmental stage:

Protein families:Peptidase M14 family


   💬 WhatsApp