SPRR3_MOUSE   O09116


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O09116

Recommended name:Small proline-rich protein 3

EC number:

Alternative names:(Cornifin beta)

Cleaved into:

GeneID:20766

Gene names  (primary ):Sprr3

Gene names  (synonym ):

Gene names  (ORF ):

Length:238

Mass:25241

Sequence:MSSYQQKQPFVPPPQPEQHQVKQPCQPPPQGKFVPIATSEPCHTDVPQPGNTKIPEPCSTKVPEPGNTVVLEPDYTTMPGPCSTNITEPDYTTIPGPCSTNITEPDYTTIPGPCSTNIPGPDRTVVPGSCSTNITEPDYTTIPGPSSTKIPDPGCAMVPGPSPSSTSEPSSEPCSINVREPGYMNASEPTHAKVPDQGYTKIPDQGSSKVPEPCQSRVPEVCPPTVTPVSAKQKTKQK

Tissue specificity:

Induction:

Developmental stage:

Protein families:Cornifin (SPRR) family


   💬 WhatsApp