C1GLT_MOUSE   Q9JJ06


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JJ06

Recommended name:Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1

EC number:EC 2.4.1.122

Alternative names:(Core 1 O-glycan T-synthase) (T-syn) (Core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase 1) (Core 1 beta1,3-galactosyltransferase 1) (C1GalT1) (Core 1 beta3-Gal-T1)

Cleaved into:

GeneID:94192

Gene names  (primary ):C1galt1

Gene names  (synonym ):Plt1

Gene names  (ORF ):

Length:363

Mass:42304

Sequence:MASKSWLNFLVFLCGSAIGFFLCSQLLSILLREEAAIQPNMLHNDPHARHSDDNGHSHLKGQMNFNADSSQHKDENIDVAENLYQKVKILCWVMTSPQNLEKKAKHVKATWAQRCNKVLFMSSEENQDFPTVGLKTKEGREQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVIVDNLRWLLSKYNPEQPIYFGRRFKPYVKQGYMSGGAGYVLSKEALRRFVNAFKTEKCTHSSSIEDLALGRCMEIINVEAGDSRDTIGKETFHPFVPEHHLIKGYLPKTFWYWNYNYYPPIEGPGCCSDIAVSFHYVDGTTMYELEYLVYHLRPYGYLYRYQPALPENILKEINQVNRKEDTKIKLGNP

Tissue specificity:Primarily expressed in endothelial, hematopoietic and epithelial cells during development. {ECO:0000269|PubMed:14745002}.

Induction:

Developmental stage:

Protein families:Glycosyltransferase 31 family, Beta3-Gal-T subfamily


   💬 WhatsApp