CXB6_MOUSE   P70689


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P70689

Recommended name:Gap junction beta-6 protein

EC number:

Alternative names:(Connexin-30) (Cx30)

Cleaved into:

GeneID:14623

Gene names  (primary ):Gjb6

Gene names  (synonym ):Cxn-30

Gene names  (ORF ):

Length:261

Mass:30366

Sequence:MDWGTLHTVIGGVNKHSTSIGKVWITVIFIFRVMILVVAAQEVWGDEQEDFVCNTLQPGCKNVCYDHFFPVSHIRLWALQLIFVSTPALLVAMHVAYYRHETARKFIRGEKRNEFKDLEDIKRQKVRIEGSLWWTYTSSIFFRIIFEAAFMYVFYFLYNGYHLPWVLKCGIDPCPNLVDCFISRPTEKTVFTVFMISASVICMLLNVAELCYLLLKLCFRRSKRTQAQRNHPNHALKESKQNEMNELISDSGQNAITSFPS

Tissue specificity:Highly expressed in adult brain and skin. Less in uterus, lung and eye. Very low in testis and sciatic nerve. No expression before birth.

Induction:

Developmental stage:

Protein families:Connexin family, Beta-type (group I) subfamily


   💬 WhatsApp