CPLX4_MOUSE Q80WM3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80WM3
Recommended name：Complexin-4
EC number：
Alternative names：(Complexin IV) (CPX IV)
Cleaved into：
GeneID：225644
Gene names (primary )：Cplx4
Gene names (synonym )：
Gene names (ORF )：
Length：160
Mass：18351
Sequence：MAFFVKNMISNQVKNLGFGGGSEEKKEEGGTSDPAAAKGMTREEYEEYQKQMIEEKMERDAAFTQKKAERACLRVHLRDKYRLPKSEMDETQIQLAGDDVDLPEDLRKMVDEDQDEEEEKDSILGQLQNLQNMDLDTIKEKAQATFTEIKQSAEQKCSVM
Tissue specificity：Present specifically in the retina (at protein level) (PubMed:15911881, PubMed:19386896, PubMed:22694764, PubMed:27335398). Expressed in the outer nuclear layer of the retina (at protein level) (PubMed:22694764). Strongly expressed at rod photoreceptor ribbon synapses (at protein level) (PubMed:15911881, PubMed:22694764). Not expressed at conventional amacrine cell synapses, nor at cone photoreceptor ribbon synapses (at protein level) (PubMed:15911881). Weakly expressed at cone photoreceptor synaptic terminals (at protein level) (PubMed:22694764). Not expressed in the brain (at protein level) (PubMed:19386896). {ECO:0000269|PubMed:15911881, ECO:0000269|PubMed:19386896, ECO:0000269|PubMed:22694764, ECO:0000269|PubMed:27335398}.
Induction：
Developmental stage：
Protein families：Complexin/synaphin family