NDUB5_MOUSE   Q9CQH3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CQH3

Recommended name:NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial

EC number:

Alternative names:(Complex I-SGDH) (CI-SGDH) (NADH-ubiquinone oxidoreductase SGDH subunit)

Cleaved into:

GeneID:66046

Gene names  (primary ):Ndufb5

Gene names  (synonym ):

Gene names  (ORF ):

Length:189

Mass:21710

Sequence:MAAMSLLQRASVSALTALSCRRAGPRLGVGSFLTRSFPKTVAPVRHSGDHGKRLFVVKPSLYYDARFLRLMKFYLMLTGIPVIIGITLVNIFIGEAELAEIPEGYIPEHWEYYKHPISRWIARNFYDGPEKNYEKTLAILQIESEKAELRLKEQEVRRLMRARGDGPWYQFPTPEKEFIDHSPKATPDN

Tissue specificity:

Induction:

Developmental stage:

Protein families:Complex I NDUFB5 subunit family


   💬 WhatsApp