NDUB6_MOUSE   Q3UIU2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3UIU2

Recommended name:NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6

EC number:

Alternative names:(Complex I-B17) (CI-B17) (NADH-ubiquinone oxidoreductase B17 subunit)

Cleaved into:

GeneID:230075

Gene names  (primary ):Ndufb6

Gene names  (synonym ):Gm137

Gene names  (ORF ):

Length:128

Mass:15515

Sequence:MSGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPRRMWPLERFWDNFLRDGAVWKNMVFKAYRSSLFAVSHVLIPMWFVHYYVKYHMATKPYTIVSSKPRIFPGDTILETGEVIPPMRDFPDQHH

Tissue specificity:

Induction:

Developmental stage:

Protein families:Complex I NDUFB6 subunit family


   💬 WhatsApp