C5AR2_MOUSE Q8BW93
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BW93
Recommended name：C5a anaphylatoxin chemotactic receptor 2
EC number：
Alternative names：(Complement component 5a receptor 2) (G-protein coupled receptor 77)
Cleaved into：
GeneID：319430
Gene names (primary )：C5ar2
Gene names (synonym )：C5l2 Gpr77
Gene names (ORF )：
Length：344
Mass：38199
Sequence：MMNHTTSEYYDYEYDHEHYSDLPDVPVDCPAGTCFTSDVYLIVLLVLYAAVFLVGVPGNTLVAWVTWKESRHRLGASWFLHLTMADLLCCVSLPFLAVPIAQKGHWPYGAAGCWLLSSITILSMYASVLLLTGLSGDLFLLAFRPSWKGADHRTFGVRVVQASSWMLGLLLTVPSAVYRRLLQEHYPPRLVCGIDYGGSVSAEVAITTVRFLFGFLGPLVFMAGCHGILQRQMARRHWPLGTAVVVGFFICWTPYHVLRVIIAAAPPHSLLLARVLEAEPLFNGLALAHSALNPIMFLYFGRKQLCKSLQAACHWALRDPQDEESAVTKVSISTSHEMVSEMPV
Tissue specificity：Highly expressed in liver and spleen. Lower levels in intestine, brain and kidney. Also expressed in adipose tissues with highest levels in gonadal and ingual fat depots. Lower levels in brown tissue. {ECO:0000269|PubMed:15833747}.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family