CLM8_MOUSE   Q6SJQ0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6SJQ0

Recommended name:CMRF35-like molecule 8

EC number:

Alternative names:(CLM-8) (CD300 antigen-like family member A) (Leukocyte mono-Ig-like receptor 1) (Mast cell-derived paired immunoglobulin-like receptor 1) (Myeloid-associated immunoglobulin-like receptor 1) (MAIR-1) (MAIR-I) (CD antigen CD300a)

Cleaved into:

GeneID:217303

Gene names  (primary ):Cd300a

Gene names  (synonym ):Clm8 Lmir1 Mcpir1

Gene names  (ORF ):

Length:318

Mass:35629

Sequence:MTQLASAVWLPTLLLLLLLFWLPGCVPLHGPSTMSGSVGESLSVSCRYEEKFKTKDKYWCRVSLKILCKDIVKTSSSEEARSGRVTIRDHPDNLTFTVTYESLTLEDADTYMCAVDISLFDGSLGFDKYFKIELSVVPSEDPVSSPGPTLETPVVSTSLPTKGPALGSNTEGHREHDYSQGLRLPALLSVLALLLFLLVGTSLLAWRMFQKRLVKADRHPELSQNLRQASEQNECQYVNLQLHTWSLREEPVLPSQVEVVEYSTLALPQEELHYSSVAFNSQRQDSHANGDSLHQPQDQKAEYSEIQKPRKGLSDLYL

Tissue specificity:Present on the surface of the majority of myeloid cells and a subset of B-cells. Present on the surface of NK cells after IL-12 stimulation. {ECO:0000269|PubMed:12874256, ECO:0000269|PubMed:12893283, ECO:0000269|PubMed:16339535}.

Induction:

Developmental stage:

Protein families:CD300 family


   💬 WhatsApp