CLM7_MOUSE   Q3U497


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3U497

Recommended name:CMRF35-like molecule 7

EC number:

Alternative names:(CLM-7) (CD300 antigen-like family member B) (Immune receptor expressed on myeloid cells 3) (IREM-3) (Leukocyte mono-Ig-like receptor 5) (CD antigen CD300b)

Cleaved into:

GeneID:217304

Gene names  (primary ):Cd300lb

Gene names  (synonym ):Irem3 Lmir5

Gene names  (ORF ):

Length:209

Mass:23755

Sequence:MWLSPALLLLSFPGCLSIQGPALVRGPEQGSVTVQCRYSSRWQTNKKWWCRGASWSTCRVLIRSTGSEKETKSGRLSIRDNQKNHSFQVTMEMLRQNDTDTYWCGIEKFGTDRGTRVKVNVYSVGKDTMSTSNQLPWPTVDGSTDMVSSDLQKRTYYMLLVFVKVPALLILVGAVLWLKRSTQKVPEEQWRHTLCSDLDSELLAKDISP

Tissue specificity:Expressed in myeloid cells (at protein level). {ECO:0000269|PubMed:17928527}.

Induction:

Developmental stage:

Protein families:CD300 family


   💬 WhatsApp