CPSF4_MOUSE Q8BQZ5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BQZ5
Recommended name:Cleavage and polyadenylation specificity factor subunit 4
EC number:
Alternative names:(Cleavage and polyadenylation specificity factor 30 kDa subunit) (CPSF 30 kDa subunit) (Clipper homolog) (Clipper/CPSF 30K)
Cleaved into:
GeneID:54188
Gene names (primary ):Cpsf4
Gene names (synonym ):Cpsf30
Gene names (ORF ):
Length:211
Mass:23653
Sequence:MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPTKRAPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ
Tissue specificity:
Induction:
Developmental stage:
Protein families:CPSF4/YTH1 family