CKS2_MOUSE   P56390


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P56390

Recommended name:Cyclin-dependent kinases regulatory subunit 2

EC number:

Alternative names:(CKS-2)

Cleaved into:

GeneID:66197

Gene names  (primary ):Cks2

Gene names  (synonym ):

Gene names  (ORF ):

Length:79

Mass:9874

Sequence:MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKEQQK

Tissue specificity:

Induction:

Developmental stage:

Protein families:CKS family


   💬 WhatsApp