CSK2B_MOUSE   P67871


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P67871

Recommended name:Casein kinase II subunit beta

EC number:

Alternative names:(CK II beta) (Phosvitin)

Cleaved into:

GeneID:13001

Gene names  (primary ):Csnk2b

Gene names  (synonym ):Ck2n

Gene names  (ORF ):

Length:215

Mass:24942

Sequence:MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR

Tissue specificity:

Induction:

Developmental stage:

Protein families:Casein kinase 2 subunit beta family


   💬 WhatsApp