CMC2_MOUSE Q9QXX4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QXX4
Recommended name：Calcium-binding mitochondrial carrier protein Aralar2
EC number：
Alternative names：(Citrin) (Mitochondrial aspartate glutamate carrier 2) (Solute carrier family 25 member 13)
Cleaved into：
GeneID：50799
Gene names (primary )：Slc25a13
Gene names (synonym )：Aralar2
Gene names (ORF )：
Length：676
Mass：74467
Sequence：MAAAKVALTKRADPAELKAIFLKYASIEKNGEFFMSPHDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQIFGQTTIHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNAKTGKVSAIDFRDIMVTIRPHVLTPFVEECLVAAAGGTRSHQVSFSYFNGFNSLLNNMELIRKIYSTLAGNRKDVEVTKEEFALAAQKFGQVTPMEVDILFQLADLYEPRGRMTLADIERIAPLEEGMLPFNLAEAQRQQKASGDAARPFLLQLAESAYRFGLGSIAGAVGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKFMHKDGSVPLLAEIFAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGFFGIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIKTRLQVAARAGQTTYNGVTDCFRKILREEGPKALWKGVAARVFRSSPQFGVTLLTYELLQRWFYVDFGGVKPVGSEPVPKSRITLPAPNPDHVGGYKLAVATFAGIENKFGLYLPLFKPSASTSKVTAGDS
Tissue specificity：At E10.5, expressed in branchial arches, a well as in the limb and tail buds. At E13.5 expression is predominant in epithelial structures and the forebrain, kidney and liver. Expression in liver is maintained into adulthood. {ECO:0000269|PubMed:10610724}.
Induction：
Developmental stage：
Protein families：Mitochondrial carrier (TC 2.A.29) family